(data stored in ACNUC7421 zone)

EMBL: CP000690.PE86

CP000690.PE86        Location/Qualifiers
FT   CDS             97123..97491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3380"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28990"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ8"
FT                   /protein_id="ABQ28990.1"
FT                   /translation="MHSATGHLILITTLTFRPSEIGEAIQSSPEIGRRIEAASRRDADT
FT                   PPTAQDSDCTKQVGQNLDSVVAALIHRGPDAHEVNDVGKQRKLNGGRAGYRWHARAAFD
FT                   HRWHGRCRWCPLRPDLLA"
     MHSATGHLIL ITTLTFRPSE IGEAIQSSPE IGRRIEAASR RDADTPPTAQ DSDCTKQVGQ        60
     NLDSVVAALI HRGPDAHEVN DVGKQRKLNG GRAGYRWHAR AAFDHRWHGR CRWCPLRPDL       120
     LA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page