(data stored in ACNUC7421 zone)

EMBL: CP000690.PE87

CP000690.PE87        Location/Qualifiers
FT   CDS             97955..98353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3381"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28991"
FT                   /db_xref="InterPro:IPR017895"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTQ9"
FT                   /protein_id="ABQ28991.1"
FT                   /translation="MKRLTMRNIREAQRLHAGGLSTRKIAASLGVGQSTASDYLKPVEH
FT                   AGLSWPLAAEMTDAALEALLFHPIGGPSRLVEAQPDWPAIHPRDCGAPALHTALLCGFG
FT                   TCPPLVQLLVKTRVPKPGGLTGGASDIA"
     MKRLTMRNIR EAQRLHAGGL STRKIAASLG VGQSTASDYL KPVEHAGLSW PLAAEMTDAA        60
     LEALLFHPIG GPSRLVEAQP DWPAIHPRDC GAPALHTALL CGFGTCPPLV QLLVKTRVPK       120
     PGGLTGGASD IA                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page