(data stored in ACNUC7421 zone)

EMBL: CP000690.PE88

CP000690.PE88        Location/Qualifiers
FT   CDS             complement(99228..100943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3383"
FT                   /product="pyruvate dehydrogenase (cytochrome)"
FT                   /note="PFAM: thiamine pyrophosphate enzyme domain protein
FT                   TPP-binding; thiamine pyrophosphate enzyme, central region;
FT                   thiamine pyrophosphate enzyme TPP binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3383"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28992"
FT                   /db_xref="GOA:A5FTR0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR0"
FT                   /protein_id="ABQ28992.1"
FT                   /translation="MASTVAEIIVDTLCQAGARRCWGIVGDTINHFTDAVRKSDLRWVH
FT                   VRHEEAGALAAGGEGYLTGELAVCAGTCGPGSLHFVNGIFESHRNGAPVVLIASDVARA
FT                   EAGLRFPQEVDQRKIYEQASVFCEYVSHPDQARRITTLAAQAALTRGGVAVVIVNGDMF
FT                   TETTDDRLEWRVHRPSSVLRPSDDELDALARDLDSAARVTIYAGIGARGAAARVVQLAG
FT                   LLKAPIVHTSRAKEFIEPNNPFNIGMTGILGNRAGVEAIDAADIMLCLGTDFAWTQFYP
FT                   DARYVIQIDSDPTHLGRRAPIRTGLVGDVGATIEALLPRLKTRSDSAHLDRSLKRWAAD
FT                   REGYAKLACAHDDALIHPQTVAQTLDTLAADDAIFTADGGSPMVWLLRHVTANGRRSFL
FT                   TSLLHGTMANAYPQAMGMAAAFPGRQVIAMCGDGGMTMLMGDLLTLVQEKLPIKLLVFN
FT                   NGSLGFVEMEQRVEGLIDSFTELKNPDFAKLAEVCGISGWRVDTGPELEPAMRRWLAAE
FT                   GPALLDVHVNRVELVMPPKVEIGQVASTALFGVRAVLDGRSREVVQLLRDNFLR"
     MASTVAEIIV DTLCQAGARR CWGIVGDTIN HFTDAVRKSD LRWVHVRHEE AGALAAGGEG        60
     YLTGELAVCA GTCGPGSLHF VNGIFESHRN GAPVVLIASD VARAEAGLRF PQEVDQRKIY       120
     EQASVFCEYV SHPDQARRIT TLAAQAALTR GGVAVVIVNG DMFTETTDDR LEWRVHRPSS       180
     VLRPSDDELD ALARDLDSAA RVTIYAGIGA RGAAARVVQL AGLLKAPIVH TSRAKEFIEP       240
     NNPFNIGMTG ILGNRAGVEA IDAADIMLCL GTDFAWTQFY PDARYVIQID SDPTHLGRRA       300
     PIRTGLVGDV GATIEALLPR LKTRSDSAHL DRSLKRWAAD REGYAKLACA HDDALIHPQT       360
     VAQTLDTLAA DDAIFTADGG SPMVWLLRHV TANGRRSFLT SLLHGTMANA YPQAMGMAAA       420
     FPGRQVIAMC GDGGMTMLMG DLLTLVQEKL PIKLLVFNNG SLGFVEMEQR VEGLIDSFTE       480
     LKNPDFAKLA EVCGISGWRV DTGPELEPAM RRWLAAEGPA LLDVHVNRVE LVMPPKVEIG       540
     QVASTALFGV RAVLDGRSRE VVQLLRDNFL R                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page