(data stored in ACNUC7421 zone)

EMBL: CP000690.PE9

CP000690.PE9         Location/Qualifiers
FT   CDS             12472..12888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3301"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3301"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28913"
FT                   /db_xref="GOA:A5FTI1"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTI1"
FT                   /protein_id="ABQ28913.1"
FT                   /translation="MAEQAKFSKLYHCVYALNYHLVLVTKYRRKCITGPMLGRFREIAA
FT                   ARCEGWGGKLIEVNGEPDHVHLLISLPPNLDLSRFVNNLKTTTSRLIRKEFAAEVDTVY
FT                   RKPVFWSRSYCVISCGGAPLSVIKQYIEQQAAPE"
     MAEQAKFSKL YHCVYALNYH LVLVTKYRRK CITGPMLGRF REIAAARCEG WGGKLIEVNG        60
     EPDHVHLLIS LPPNLDLSRF VNNLKTTTSR LIRKEFAAEV DTVYRKPVFW SRSYCVISCG       120
     GAPLSVIKQY IEQQAAPE                                                     138
//

If you have problems or comments...

PBIL Back to PBIL home page