(data stored in ACNUC7421 zone)

EMBL: CP000690.PE90

CP000690.PE90        Location/Qualifiers
FT   CDS             103176..104042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3385"
FT                   /product="MltA-interacting MipA family protein"
FT                   /note="PFAM: MltA-interacting MipA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3385"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28994"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR2"
FT                   /protein_id="ABQ28994.1"
FT                   /translation="MNRFSELLGSRKPIWLLAPFAVTCSATPARAQTPSPLAEWQYSSG
FT                   IQLQRLFEPKIPTWQVELGLGTQFAPAAPGLNRYRIQGGPGIDIRYKNRFFLSTGEGLG
FT                   VNLFSFRHISFGTAISYDLGRSPHVDGEALNGLGTIHPAPELKVFATTVLTEGFPLTIR
FT                   VDIRKQFGASFGYIGDVGAYMPMPGSSKTFSWFLGPTVTLADARYMNTYFGVSHAQAAS
FT                   SKYHYYHAHGGFRSAGIGISANYFVTPHVIINLNAAYERLLGSAAKSPITQTVNEGVVS
FT                   LSALYKF"
     MNRFSELLGS RKPIWLLAPF AVTCSATPAR AQTPSPLAEW QYSSGIQLQR LFEPKIPTWQ        60
     VELGLGTQFA PAAPGLNRYR IQGGPGIDIR YKNRFFLSTG EGLGVNLFSF RHISFGTAIS       120
     YDLGRSPHVD GEALNGLGTI HPAPELKVFA TTVLTEGFPL TIRVDIRKQF GASFGYIGDV       180
     GAYMPMPGSS KTFSWFLGPT VTLADARYMN TYFGVSHAQA ASSKYHYYHA HGGFRSAGIG       240
     ISANYFVTPH VIINLNAAYE RLLGSAAKSP ITQTVNEGVV SLSALYKF                    288
//

If you have problems or comments...

PBIL Back to PBIL home page