(data stored in ACNUC7421 zone)

EMBL: CP000690.PE91

CP000690.PE91        Location/Qualifiers
FT   CDS             complement(104254..104646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3386"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3386"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28995"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR3"
FT                   /protein_id="ABQ28995.1"
FT                   /translation="MLRTNARVTPLQAVIRYRDLLEVEALFRAAKASFDTRPIFHQADA
FT                   AIRGHVFCSFLALTLAKELNRLCGARGFQPEWQKLLNDLDRLQQATIEKGGKVITTRTH
FT                   VTGQVGNVFKAASIALPHNISEHPAD"
     MLRTNARVTP LQAVIRYRDL LEVEALFRAA KASFDTRPIF HQADAAIRGH VFCSFLALTL        60
     AKELNRLCGA RGFQPEWQKL LNDLDRLQQA TIEKGGKVIT TRTHVTGQVG NVFKAASIAL       120
     PHNISEHPAD                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page