(data stored in ACNUC7421 zone)

EMBL: CP000690.PE94

CP000690.PE94        Location/Qualifiers
FT   CDS             complement(106903..107499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3389"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28998"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR6"
FT                   /protein_id="ABQ28998.1"
FT                   /translation="MHDQFACSCRFRVLNIVERRVMTSTTARAQQAPGEKIRRFKEFND
FT                   GAASWDRVERIIARVEAWPLGGDTRFIVTSLKAGSPRTLYQEIYCARGQAENHIKAWKT
FT                   NLAADRTSCSRASANQMRLFLHIGAYWLMWSFRSLMPRRSRWRGIQFNTLHLRLIKLAV
FT                   RLETLKRSIRMHLPRSMPDQAILGYAPARLPRLVS"
     MHDQFACSCR FRVLNIVERR VMTSTTARAQ QAPGEKIRRF KEFNDGAASW DRVERIIARV        60
     EAWPLGGDTR FIVTSLKAGS PRTLYQEIYC ARGQAENHIK AWKTNLAADR TSCSRASANQ       120
     MRLFLHIGAY WLMWSFRSLM PRRSRWRGIQ FNTLHLRLIK LAVRLETLKR SIRMHLPRSM       180
     PDQAILGYAP ARLPRLVS                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page