(data stored in ACNUC7421 zone)

EMBL: CP000690.PE95

CP000690.PE95        Location/Qualifiers
FT   CDS             109594..111663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3392"
FT                   /product="Resolvase, N-terminal domain"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3392"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ28999"
FT                   /db_xref="GOA:A5FTR7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR7"
FT                   /protein_id="ABQ28999.1"
FT                   /translation="MHEKIGPHHLERKALLYVRQSSAHQVLHNRESSALQYAMRDRLTV
FT                   LGWSSIETIDDDLGRSAAGGVTRAGFDRMVAEVCLGKVGAVAAREVSRFARNSRDWQQL
FT                   IEMCRVVDTVLIDQETVYAPRQSNDRLLLGLKGSLNEYELDLLRQRSLSARYEKARRGE
FT                   LLVAAPVGFMKAGDRLEKDPDRRVQEAITLVFDKVAELGSARQALLWFLEHSLDLPARR
FT                   ANGDVVWRRPTYATIHRMIENPVYGGAYAYGKTRVTPRHDAIVPRSSSRRKRRGDWLAL
FT                   KPGAHEGYVSWERAEAIRTMVSDNIPASRHHGAPKHGDALLAGLLRCRRCGRKLTVRYT
FT                   GTNHNIPRYSCWRGLLDNGEPRCIAFGGLRVDDAIEEALLRVVEPGAIAAAAAAEAQAA
FT                   GRRDQVREALVRDLEAARYQADRAFRQYDAADPANRLVAAELETRWNRALAQAAEVEAR
FT                   IAEHDAAAPNSSSLAVLDAARLGTNLRAVWAAPTTDSRLKKRIVRTVIHEVVADIDDTA
FT                   SEIVLLVHWIGGAHTELRLPTRRRGQRNSTASEIIAAVRHLALIASDDLIAGILNRNRL
FT                   LTGHGNRWTRERVTALRSHHKIQVFRPAPDGIEPQLNLTDAARLLGVAPKTLRLAAEAG
FT                   VIEGDHPLPDGPWIFRRSELAKPAAAQITHRARQNPKHPAGSHPDQKNLSLSTT"
     MHEKIGPHHL ERKALLYVRQ SSAHQVLHNR ESSALQYAMR DRLTVLGWSS IETIDDDLGR        60
     SAAGGVTRAG FDRMVAEVCL GKVGAVAARE VSRFARNSRD WQQLIEMCRV VDTVLIDQET       120
     VYAPRQSNDR LLLGLKGSLN EYELDLLRQR SLSARYEKAR RGELLVAAPV GFMKAGDRLE       180
     KDPDRRVQEA ITLVFDKVAE LGSARQALLW FLEHSLDLPA RRANGDVVWR RPTYATIHRM       240
     IENPVYGGAY AYGKTRVTPR HDAIVPRSSS RRKRRGDWLA LKPGAHEGYV SWERAEAIRT       300
     MVSDNIPASR HHGAPKHGDA LLAGLLRCRR CGRKLTVRYT GTNHNIPRYS CWRGLLDNGE       360
     PRCIAFGGLR VDDAIEEALL RVVEPGAIAA AAAAEAQAAG RRDQVREALV RDLEAARYQA       420
     DRAFRQYDAA DPANRLVAAE LETRWNRALA QAAEVEARIA EHDAAAPNSS SLAVLDAARL       480
     GTNLRAVWAA PTTDSRLKKR IVRTVIHEVV ADIDDTASEI VLLVHWIGGA HTELRLPTRR       540
     RGQRNSTASE IIAAVRHLAL IASDDLIAGI LNRNRLLTGH GNRWTRERVT ALRSHHKIQV       600
     FRPAPDGIEP QLNLTDAARL LGVAPKTLRL AAEAGVIEGD HPLPDGPWIF RRSELAKPAA       660
     AQITHRARQN PKHPAGSHPD QKNLSLSTT                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page