(data stored in ACNUC7421 zone)

EMBL: CP000690.PE96

CP000690.PE96        Location/Qualifiers
FT   CDS             complement(111675..112499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3393"
FT                   /product="Integrase, catalytic region"
FT                   /note="PFAM: Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3393"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29000"
FT                   /db_xref="GOA:A5FTR8"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR8"
FT                   /protein_id="ABQ29000.1"
FT                   /translation="MAPGRLLYKGERGGPFHKILAPSHKREAVAHLQSLFEVSQRRACD
FT                   ALGVDRTTVRYQSRRPDDAEARERIRVLAGERRRFGYRRLHWLLSREGISMNHKKFRRL
FT                   YREERLQVRRRGGRKRALGTRSPMTIPQGCNQRWSLDFVSDALTCGRRFRIFAVVDDFS
FT                   RECVRLIADTSISGARLARELDMAITERGARPLMVVSDDGTELTSMSILRWSKERNVEW
FT                   HYIAPGKPQQNGFVESFNARLRDECLNETLFTSLPQARSVLAAWRHDYNPVS"
     MAPGRLLYKG ERGGPFHKIL APSHKREAVA HLQSLFEVSQ RRACDALGVD RTTVRYQSRR        60
     PDDAEARERI RVLAGERRRF GYRRLHWLLS REGISMNHKK FRRLYREERL QVRRRGGRKR       120
     ALGTRSPMTI PQGCNQRWSL DFVSDALTCG RRFRIFAVVD DFSRECVRLI ADTSISGARL       180
     ARELDMAITE RGARPLMVVS DDGTELTSMS ILRWSKERNV EWHYIAPGKP QQNGFVESFN       240
     ARLRDECLNE TLFTSLPQAR SVLAAWRHDY NPVS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page