(data stored in ACNUC7421 zone)

EMBL: CP000690.PE97

CP000690.PE97        Location/Qualifiers
FT   CDS             112521..113435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3394"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase, IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3394"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29001"
FT                   /db_xref="GOA:A5FTR9"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTR9"
FT                   /protein_id="ABQ29001.1"
FT                   /translation="MKTEIAVLGIDLGKNSCSLAGLDGTGAVIKRRRMRPETVVTFTKE
FT                   LPPCVIAMEACCGAHHLARLLAAQGHDVRLMSPEYVRPYVKAQKNDDRDAEAIAEAATR
FT                   PTMRFVSMKTEEQLDMQTLHRARDRLVGERTALINQLRAILLERGVTVPQGRSKLERSL
FT                   IEMFDGDEAEPPATLTPRLRALIADMRAEWRELDRRITAFEDEFVARTREDEAARRLIS
FT                   IPGIGVMNATALIAAIGNGETFSRGRDLAAWLGLVPRQITTGGRPRLVGISKRGNKYLR
FT                   KLLIHGARAALPSLLTSSTPLGG"
     MKTEIAVLGI DLGKNSCSLA GLDGTGAVIK RRRMRPETVV TFTKELPPCV IAMEACCGAH        60
     HLARLLAAQG HDVRLMSPEY VRPYVKAQKN DDRDAEAIAE AATRPTMRFV SMKTEEQLDM       120
     QTLHRARDRL VGERTALINQ LRAILLERGV TVPQGRSKLE RSLIEMFDGD EAEPPATLTP       180
     RLRALIADMR AEWRELDRRI TAFEDEFVAR TREDEAARRL ISIPGIGVMN ATALIAAIGN       240
     GETFSRGRDL AAWLGLVPRQ ITTGGRPRLV GISKRGNKYL RKLLIHGARA ALPSLLTSST       300
     PLGG                                                                    304
//

If you have problems or comments...

PBIL Back to PBIL home page