(data stored in ACNUC7421 zone)

EMBL: CP000690.PE98

CP000690.PE98        Location/Qualifiers
FT   CDS             complement(113781..114083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3395"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3395"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29002"
FT                   /db_xref="GOA:A5FTS0"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS0"
FT                   /protein_id="ABQ29002.1"
FT                   /translation="MKSSRFSEEQIIGILKEQESGMSTAEVCRRHGISSATFYKWKAKF
FT                   GGLEVSDARRLKQLEDENARLKRLLADAVLDNAMLKEIASKTYGPPRLQVVFSMN"
     MKSSRFSEEQ IIGILKEQES GMSTAEVCRR HGISSATFYK WKAKFGGLEV SDARRLKQLE        60
     DENARLKRLL ADAVLDNAML KEIASKTYGP PRLQVVFSMN                             100
//

If you have problems or comments...

PBIL Back to PBIL home page