(data stored in ACNUC7421 zone)

EMBL: CP000690.PE99

CP000690.PE99        Location/Qualifiers
FT   CDS             complement(114946..115974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Acry_3396"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   C-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Acry_3396"
FT                   /db_xref="EnsemblGenomes-Tr:ABQ29003"
FT                   /db_xref="GOA:A5FTS1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A5FTS1"
FT                   /protein_id="ABQ29003.1"
FT                   /translation="MARVLVTGGTGFLGAHCIIQLLAAGHEVRATVRDLRRKDAVEAML
FT                   RQGGAEITTDQVALFAADLTADAGWNEAIANCDYILHVASPYPRSIPKDENELIRPARD
FT                   GTLRVLRVARDANVKRVVLTSSFAAIGYGNGHTGIFTENDWTDPDDPTIQPYQRSKTLA
FT                   ERAAWAFMNREGGALELAVVNPTGILGPLLGPDLSTSIHLIKRMMEGSTPGCPDLWFGV
FT                   LDARDAADLHLRAMTDPAAAGERFLATAGHFMSVTQVAQTLKDRLGNAACAVSTRQLPN
FT                   WLLRAAALFDPEVRPLLPELGKRKNATAAKAQRLLGWTPRSPEDAIIATATSLVELKLL
FT                   KS"
     MARVLVTGGT GFLGAHCIIQ LLAAGHEVRA TVRDLRRKDA VEAMLRQGGA EITTDQVALF        60
     AADLTADAGW NEAIANCDYI LHVASPYPRS IPKDENELIR PARDGTLRVL RVARDANVKR       120
     VVLTSSFAAI GYGNGHTGIF TENDWTDPDD PTIQPYQRSK TLAERAAWAF MNREGGALEL       180
     AVVNPTGILG PLLGPDLSTS IHLIKRMMEG STPGCPDLWF GVLDARDAAD LHLRAMTDPA       240
     AAGERFLATA GHFMSVTQVA QTLKDRLGNA ACAVSTRQLP NWLLRAAALF DPEVRPLLPE       300
     LGKRKNATAA KAQRLLGWTP RSPEDAIIAT ATSLVELKLL KS                          342
//

If you have problems or comments...

PBIL Back to PBIL home page