(data stored in ACNUC1104 zone)

EMBL: CP000717.PE1

CP000717.PE1         Location/Qualifiers
FT   CDS             102..1625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10001"
FT                   /old_locus_tag="TBFG_00001"
FT                   /product="chromosomal replication initiator protein dnaA"
FT                   /note="Mapped to H37Rv Rv0001"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10001"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04344"
FT                   /protein_id="ABR04344.1"
FT                   /translation="MTDDPGSGFTTVWNAVVSELNGDPKVDDGPSSDANLSAPLTPQQR
FT                   AWLNLVQPLTIVEGFALLSVPSSFVQNEIERHLRAPITDALSRRLGHQIQLGVRIAPPA
FT                   TDEADDTTVPPSENPATTSPDTTTDNDEIDDSAAARGDNQHSWPSYFTERPHNTDSATA
FT                   GVTSLNRRYTFDTFVIGASNRFAHAAALAIAEAPARAYNPLFIWGESGLGKTHLLHAAG
FT                   NYAQRLFPGMRVKYVSTEEFTNDFINSLRDDRKVAFKRSYRDVDVLLVDDIQFIEGKEG
FT                   IQEEFFHTFNTLHNANKQIVISSDRPPKQLATLEDRLRTRFEWGLITDVQPPELETRIA
FT                   ILRKKAQMERLAVPDDVLELIASSIERNIRELEGALIRVTAFASLNKTPIDKALAEIVL
FT                   RDLIADANTMQISAATIMAATAEYFDTTVEELRGPGKTRALAQSRQIAMYLCRELTDLS
FT                   LPKIGQAFGRDHTTVMYAQRKILSEMAERREVFDHVKELTTRIRQRSKR"
     MTDDPGSGFT TVWNAVVSEL NGDPKVDDGP SSDANLSAPL TPQQRAWLNL VQPLTIVEGF        60
     ALLSVPSSFV QNEIERHLRA PITDALSRRL GHQIQLGVRI APPATDEADD TTVPPSENPA       120
     TTSPDTTTDN DEIDDSAAAR GDNQHSWPSY FTERPHNTDS ATAGVTSLNR RYTFDTFVIG       180
     ASNRFAHAAA LAIAEAPARA YNPLFIWGES GLGKTHLLHA AGNYAQRLFP GMRVKYVSTE       240
     EFTNDFINSL RDDRKVAFKR SYRDVDVLLV DDIQFIEGKE GIQEEFFHTF NTLHNANKQI       300
     VISSDRPPKQ LATLEDRLRT RFEWGLITDV QPPELETRIA ILRKKAQMER LAVPDDVLEL       360
     IASSIERNIR ELEGALIRVT AFASLNKTPI DKALAEIVLR DLIADANTMQ ISAATIMAAT       420
     AEYFDTTVEE LRGPGKTRAL AQSRQIAMYL CRELTDLSLP KIGQAFGRDH TTVMYAQRKI       480
     LSEMAERREV FDHVKELTTR IRQRSKR                                           507
//

If you have problems or comments...

PBIL Back to PBIL home page