(data stored in ACNUC1104 zone)

EMBL: CP000717.PE101

CP000717.PE101       Location/Qualifiers
FT   CDS             109917..110153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10101"
FT                   /old_locus_tag="TBFG_00100"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0100"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10101"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04444"
FT                   /protein_id="ABR04444.1"
FT                   /translation="MRDRILAAVCDVLYIDEADLIDGDETDLRDLGLDSVRFVLLMKQL
FT                   GVNRQSELPSRLAANPSIAGWLRELEAVCTEFG"
     MRDRILAAVC DVLYIDEADL IDGDETDLRD LGLDSVRFVL LMKQLGVNRQ SELPSRLAAN        60
     PSIAGWLREL EAVCTEFG                                                      78
//

If you have problems or comments...

PBIL Back to PBIL home page