(data stored in ACNUC1104 zone)

EMBL: CP000717.PE107

CP000717.PE107       Location/Qualifiers
FT   CDS             124508..125704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10107"
FT                   /old_locus_tag="TBFG_00105"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0106"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10107"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04450"
FT                   /protein_id="ABR04450.1"
FT                   /translation="MRTPVILVAGQDHTDEVTGALLRRTGTVVVEHRFDGHVVRRMTAT
FT                   LSRGELITTEDALEFAHGCVSCTIRDDLLVLLRRLHRRDNVGRIVVHLAPWLEPQPICW
FT                   AIDHVRVCVGHGYPDGPAALDVRVAAVVTCVDCVRWLPQSLGEDELPDGRTVAQVTVGQ
FT                   AEFADLLVLTHPEPVAVAVLRRLAPRARITGGVDRVELALAHLDDNSRRGRTDTPHTPL
FT                   LAGLPPLAADGEVAIVEFSARRPFHPQRLHAAVDLLLDGVVRTRGRLWLANRPDQVMWL
FT                   ESAGGGLRVASAGKWLAAMAASEVAYVDLERRLFADLMWVYPFGDRHTAMTVLVCGADP
FT                   TDIVNALNAALLSDDEMASPQRWQSYVDPFGDWHDDPCHEMPDAAGEFSAHRNSGESR"
     MRTPVILVAG QDHTDEVTGA LLRRTGTVVV EHRFDGHVVR RMTATLSRGE LITTEDALEF        60
     AHGCVSCTIR DDLLVLLRRL HRRDNVGRIV VHLAPWLEPQ PICWAIDHVR VCVGHGYPDG       120
     PAALDVRVAA VVTCVDCVRW LPQSLGEDEL PDGRTVAQVT VGQAEFADLL VLTHPEPVAV       180
     AVLRRLAPRA RITGGVDRVE LALAHLDDNS RRGRTDTPHT PLLAGLPPLA ADGEVAIVEF       240
     SARRPFHPQR LHAAVDLLLD GVVRTRGRLW LANRPDQVMW LESAGGGLRV ASAGKWLAAM       300
     AASEVAYVDL ERRLFADLMW VYPFGDRHTA MTVLVCGADP TDIVNALNAA LLSDDEMASP       360
     QRWQSYVDPF GDWHDDPCHE MPDAAGEFSA HRNSGESR                               398
//

If you have problems or comments...

PBIL Back to PBIL home page