(data stored in ACNUC1104 zone)

EMBL: CP000717.PE111

CP000717.PE111       Location/Qualifiers
FT   CDS             133051..133905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10111"
FT                   /old_locus_tag="TBFG_00109"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0110"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10111"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04454"
FT                   /protein_id="ABR04454.1"
FT                   /translation="MSGASSSESPTCYRHPGRRTYVRCTRCDRYICGECMRVGPVGHQC
FT                   AECVREGARAVRQPRTPFGGRQRSATPVVTYTLISLNALVFVMQVTVMGLERQLALWPP
FT                   AVASGQTYRLVTSAFLHYGAMHLLLNMWALYVVGPPLEMWLGRLRFGALYAVSALGGSV
FT                   LVYLIAPLNTATAGASGAVFGLFGATFMVARRLHLDVRWVVALIVINLAFTFLAPAISW
FT                   QGHVGGLVTGALVAATYVYAPRERRNLIQATVTITVLVAFVVLIGWRTVDLLALFGGRL
FT                   NLS"
     MSGASSSESP TCYRHPGRRT YVRCTRCDRY ICGECMRVGP VGHQCAECVR EGARAVRQPR        60
     TPFGGRQRSA TPVVTYTLIS LNALVFVMQV TVMGLERQLA LWPPAVASGQ TYRLVTSAFL       120
     HYGAMHLLLN MWALYVVGPP LEMWLGRLRF GALYAVSALG GSVLVYLIAP LNTATAGASG       180
     AVFGLFGATF MVARRLHLDV RWVVALIVIN LAFTFLAPAI SWQGHVGGLV TGALVAATYV       240
     YAPRERRNLI QATVTITVLV AFVVLIGWRT VDLLALFGGR LNLS                        284
//

If you have problems or comments...

PBIL Back to PBIL home page