(data stored in ACNUC1104 zone)

EMBL: CP000717.PE116

CP000717.PE116       Location/Qualifiers
FT   CDS             138649..139809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10116"
FT                   /old_locus_tag="TBFG_00114"
FT                   /product="D-alpha-D-heptose-7-phosphate kinase hddA"
FT                   /note="Mapped to H37Rv Rv0115"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10116"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04459"
FT                   /protein_id="ABR04459.1"
FT                   /translation="MAILRGRAPLRLGLGGGGTDVEPYSSQFGGRILSVTIDKYAYAFA
FT                   ERGTGDEIAFRSPDRDRAGQASIDDLASLEEDFPLHVAVYRRVIAEFNGGTPFPLQLAT
FT                   QVDAPPGSGLGSSSALVVAMLLTTCALIGSSPGPYELARLAWEIERVDLGMAGGWQDHY
FT                   AAAFGGFNFMESRPNGEVVVNPLRIRREVIAELEASLLLYFGGVSRLSSEVIADQQRNV
FT                   VERDADALAATHSICAEALEMKDLLVVGDIPGFADSLLRGWQAKKRTSTRISNPAIEHA
FT                   YQVAQSSGMVAGKVSGAGGGGFLMMIVDPRRRIEVARSLERECGGSVAPCLFTKGGAVT
FT                   WHIPESTAPVRRGVADAVASALGNAGILLCAGCVLATSHSTWRVPV"
     MAILRGRAPL RLGLGGGGTD VEPYSSQFGG RILSVTIDKY AYAFAERGTG DEIAFRSPDR        60
     DRAGQASIDD LASLEEDFPL HVAVYRRVIA EFNGGTPFPL QLATQVDAPP GSGLGSSSAL       120
     VVAMLLTTCA LIGSSPGPYE LARLAWEIER VDLGMAGGWQ DHYAAAFGGF NFMESRPNGE       180
     VVVNPLRIRR EVIAELEASL LLYFGGVSRL SSEVIADQQR NVVERDADAL AATHSICAEA       240
     LEMKDLLVVG DIPGFADSLL RGWQAKKRTS TRISNPAIEH AYQVAQSSGM VAGKVSGAGG       300
     GGFLMMIVDP RRRIEVARSL ERECGGSVAP CLFTKGGAVT WHIPESTAPV RRGVADAVAS       360
     ALGNAGILLC AGCVLATSHS TWRVPV                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page