(data stored in ACNUC1104 zone)

EMBL: CP000717.PE12

CP000717.PE12        Location/Qualifiers
FT   CDS             14190..14978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10012"
FT                   /old_locus_tag="TBFG_00012"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0012"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10012"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04355"
FT                   /protein_id="ABR04355.1"
FT                   /translation="MRLTHPTPCPENGETMIDRRRSAWRFSVPLVCLLAGLLLAATHGV
FT                   SGGTEIRRSNAPRLVDLVRRAQASVNRLATEREALTTRIDSVHGRSVDTALAAMQRRSA
FT                   KLAGVAAMNPVHGPGLVVTLQDAQRDANGRFPRDASPDDLVVHQQDIEAVLNALWNAGA
FT                   EAIQMQDQRIIAMSIARCVGNTLLLNGRTYSPPYTIAAIGDAAAMQAALAAAPLVTLYK
FT                   QYVVRFGLGYREEVHPDLQIVGYADPVRMHFAQPAGPLDY"
     MRLTHPTPCP ENGETMIDRR RSAWRFSVPL VCLLAGLLLA ATHGVSGGTE IRRSNAPRLV        60
     DLVRRAQASV NRLATEREAL TTRIDSVHGR SVDTALAAMQ RRSAKLAGVA AMNPVHGPGL       120
     VVTLQDAQRD ANGRFPRDAS PDDLVVHQQD IEAVLNALWN AGAEAIQMQD QRIIAMSIAR       180
     CVGNTLLLNG RTYSPPYTIA AIGDAAAMQA ALAAAPLVTL YKQYVVRFGL GYREEVHPDL       240
     QIVGYADPVR MHFAQPAGPL DY                                                262
//

If you have problems or comments...

PBIL Back to PBIL home page