(data stored in ACNUC1104 zone)

EMBL: CP000717.PE122

CP000717.PE122       Location/Qualifiers
FT   CDS             complement(148044..148478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10122"
FT                   /old_locus_tag="TBFG_00120"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0121c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10122"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04465"
FT                   /protein_id="ABR04465.1"
FT                   /translation="MGEFDPKLRFAQSPVARLATSTPDGTPHLVPVVFALGARRPAEAT
FT                   GADVIYTAVDAKRKTTQRLRRLANLEHNPRASVLVDSYADDWTQLWWVRADGVAAIHRD
FT                   GEVMRAAYRLLRAKYAQYQSVPLNGPVIAIAVQRWASWHA"
     MGEFDPKLRF AQSPVARLAT STPDGTPHLV PVVFALGARR PAEATGADVI YTAVDAKRKT        60
     TQRLRRLANL EHNPRASVLV DSYADDWTQL WWVRADGVAA IHRDGEVMRA AYRLLRAKYA       120
     QYQSVPLNGP VIAIAVQRWA SWHA                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page