(data stored in ACNUC1104 zone)

EMBL: CP000717.PE129

CP000717.PE129       Location/Qualifiers
FT   CDS             155983..156762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10129"
FT                   /old_locus_tag="TBFG_00127"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0128"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10129"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04472"
FT                   /protein_id="ABR04472.1"
FT                   /translation="MQREIYDGEARLSWVLAALAGILGATAFTHSAGYFVTFMTGNSQR
FT                   AVLGLFGDDAWMSVTASLLILFFVAGVVIASVCRRHFWAAHPHGPTVLTTFSLIFAAGV
FT                   DIMLGGWHESMLDFVPILFVVFGIGALNTSFVKDGEVSVPLSYVTGTLVKMGQGIERHL
FT                   AGGKVEDWLGYFLLHASFVLGAAAGGAISMVVTGPQMLAVAAVVCAATTGYTYLHADRR
FT                   GLVNQKRPQPGKRLFRALRRGELDSGTSTPATNYGSS"
     MQREIYDGEA RLSWVLAALA GILGATAFTH SAGYFVTFMT GNSQRAVLGL FGDDAWMSVT        60
     ASLLILFFVA GVVIASVCRR HFWAAHPHGP TVLTTFSLIF AAGVDIMLGG WHESMLDFVP       120
     ILFVVFGIGA LNTSFVKDGE VSVPLSYVTG TLVKMGQGIE RHLAGGKVED WLGYFLLHAS       180
     FVLGAAAGGA ISMVVTGPQM LAVAAVVCAA TTGYTYLHAD RRGLVNQKRP QPGKRLFRAL       240
     RRGELDSGTS TPATNYGSS                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page