(data stored in ACNUC1104 zone)

EMBL: CP000717.PE141

CP000717.PE141       Location/Qualifiers
FT   CDS             167226..167606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10141"
FT                   /old_locus_tag="TBFG_00139"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0140"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10141"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04484"
FT                   /protein_id="ABR04484.1"
FT                   /translation="MSNRIVLEPSADHPITIEPTNRRVQVRVNGEVVADTAAALCLQEA
FT                   SYPAVQYIPLADVVQDRLIRTETSTYCPFKGEASYYSVTTDAGDIVDDVMWTYENPYPA
FT                   VAAIAGHVACYPDKAEISIFPG"
     MSNRIVLEPS ADHPITIEPT NRRVQVRVNG EVVADTAAAL CLQEASYPAV QYIPLADVVQ        60
     DRLIRTETST YCPFKGEASY YSVTTDAGDI VDDVMWTYEN PYPAVAAIAG HVACYPDKAE       120
     ISIFPG                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page