(data stored in ACNUC1104 zone)

EMBL: CP000717.PE144

CP000717.PE144       Location/Qualifiers
FT   CDS             complement(169020..170498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10144"
FT                   /old_locus_tag="TBFG_00142"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0143c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10144"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04487"
FT                   /protein_id="ABR04487.1"
FT                   /translation="MAPGDWSVFAWHAANLPTMPEAEDIGNEAAGGRFGVSIRSAGYLR
FT                   KWFLLGITIGVIAGLGAVVFYLALKYTSEFLLGYLADYQIPTPVGEGGHRGSTGFARPW
FT                   AIPLVTTGGAVLSALIVAKLAPEATGHGTDEAIESVHGDPRAIRGRAVLVKMVASALTI
FT                   GSGGSGGREGPTAQISAGFCSLLTRRLNLSNEDGRTAVALGIGAGIGAIFAAPLGGAAL
FT                   GASIPYRDDFDYRNLLPGFIASGTAYAVLGAFLGFDPLFGYIDAEYRFEKAWPLLWFVV
FT                   IGLIAAAVGYLYARVFHASVAITRRLPGGPVLKPAIGGLLVGLLGLPIPQILSSGYGWA
FT                   QLAADRGTLLSIPLWIVIVLPIAKILATSLSIGTGGSGGLFGPGIVIGAFVGAAIWRLG
FT                   ELTELPGVPHEPGIFVVVAMMACFGSVSRAPLAVMIMVAEMTGSFSVVPGAIIAVGIAA
FT                   LLLSRTNVTIYETQRLNRQTAEAERGGSDRPTTA"
     MAPGDWSVFA WHAANLPTMP EAEDIGNEAA GGRFGVSIRS AGYLRKWFLL GITIGVIAGL        60
     GAVVFYLALK YTSEFLLGYL ADYQIPTPVG EGGHRGSTGF ARPWAIPLVT TGGAVLSALI       120
     VAKLAPEATG HGTDEAIESV HGDPRAIRGR AVLVKMVASA LTIGSGGSGG REGPTAQISA       180
     GFCSLLTRRL NLSNEDGRTA VALGIGAGIG AIFAAPLGGA ALGASIPYRD DFDYRNLLPG       240
     FIASGTAYAV LGAFLGFDPL FGYIDAEYRF EKAWPLLWFV VIGLIAAAVG YLYARVFHAS       300
     VAITRRLPGG PVLKPAIGGL LVGLLGLPIP QILSSGYGWA QLAADRGTLL SIPLWIVIVL       360
     PIAKILATSL SIGTGGSGGL FGPGIVIGAF VGAAIWRLGE LTELPGVPHE PGIFVVVAMM       420
     ACFGSVSRAP LAVMIMVAEM TGSFSVVPGA IIAVGIAALL LSRTNVTIYE TQRLNRQTAE       480
     AERGGSDRPT TA                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page