(data stored in ACNUC1104 zone)

EMBL: CP000717.PE145

CP000717.PE145       Location/Qualifiers
FT   CDS             170600..171442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10145"
FT                   /old_locus_tag="TBFG_00143"
FT                   /product="hypothetical transcriptional regulatory protein,
FT                   tetR-family"
FT                   /note="Mapped to H37Rv Rv0144"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10145"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04488"
FT                   /protein_id="ABR04488.1"
FT                   /translation="MPHSWTPTSVMTPPLVVAAFRPVGHYRLATDRAGGPCSPPATGAK
FT                   LTSSVASRPTVGTKPQWWHTLVMSMSLTAGRGPGRPPAAKADETRKRILHAARQVFSER
FT                   GYDGATFQEIAVRADLTRPAINHYFANKRVLYQEVVEQTHELVIVAGIERARREPTLMG
FT                   RLAVVVDFAMEADAQYPASTAFLATTVLESQRHPELSRTENDAVRATREFLVWAVNDAI
FT                   ERGELAADVDVSSLAETLLVVLCGVGFYIGFVGSYQRMATITDSFQQLLAGTLWRPPT"
     MPHSWTPTSV MTPPLVVAAF RPVGHYRLAT DRAGGPCSPP ATGAKLTSSV ASRPTVGTKP        60
     QWWHTLVMSM SLTAGRGPGR PPAAKADETR KRILHAARQV FSERGYDGAT FQEIAVRADL       120
     TRPAINHYFA NKRVLYQEVV EQTHELVIVA GIERARREPT LMGRLAVVVD FAMEADAQYP       180
     ASTAFLATTV LESQRHPELS RTENDAVRAT REFLVWAVND AIERGELAAD VDVSSLAETL       240
     LVVLCGVGFY IGFVGSYQRM ATITDSFQQL LAGTLWRPPT                             280
//

If you have problems or comments...

PBIL Back to PBIL home page