(data stored in ACNUC1104 zone)

EMBL: CP000717.PE153

CP000717.PE153       Location/Qualifiers
FT   CDS             complement(179635..181236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10153"
FT                   /old_locus_tag="TBFG_00151"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0152c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10153"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04496"
FT                   /protein_id="ABR04496.1"
FT                   /translation="MHWPRRPAMRCRPPSRNRSAHTARNTRPCSLKSRRFTVRFHQTLA
FT                   AAANSYADAEAAIASTRQNQLAVPAAAPTPAAAAMIPPFPANLTTLFFGPTGIPLPPPS
FT                   MLTPPIRCRSVRRALQAVFTPEELYPLTGVRSLVLNTSVEEGLTILHDAIMVELATTGN
FT                   AVTVFGWSQSAIIASLEMQRFTAMGGAAPSASDLNFVLVGNEMNPNGGMLARFPDLTLP
FT                   TLDLTFYGATPSDTIYPTAIYTLEYDGFADFSRYPLNFISDLNAVAGITFVHTKYLDLT
FT                   PAQVEGATKLPTSPGYTEVTDYYIIRTENRPLLQPLRAVPVIGDPLADLIQPNLKVIVN
FT                   LGYGDPNYGYSTSYADVRTPFGLWPNVPPQVIADALAAGTQEGILDFTADLQALSAQPL
FT                   TLPQIQLPQPADLVAAVAAAPTPAEVVNTLARIISTNYAVLLPTVDIALALVTTLPLYT
FT                   TQLFVRQLAAGNLINAIGYPLAATVGLGTIDSGRRGIAHPPRGGLGHRSKHRGPRHLTD
FT                   SRRHRRPPTTVYRPRQ"
     MHWPRRPAMR CRPPSRNRSA HTARNTRPCS LKSRRFTVRF HQTLAAAANS YADAEAAIAS        60
     TRQNQLAVPA AAPTPAAAAM IPPFPANLTT LFFGPTGIPL PPPSMLTPPI RCRSVRRALQ       120
     AVFTPEELYP LTGVRSLVLN TSVEEGLTIL HDAIMVELAT TGNAVTVFGW SQSAIIASLE       180
     MQRFTAMGGA APSASDLNFV LVGNEMNPNG GMLARFPDLT LPTLDLTFYG ATPSDTIYPT       240
     AIYTLEYDGF ADFSRYPLNF ISDLNAVAGI TFVHTKYLDL TPAQVEGATK LPTSPGYTEV       300
     TDYYIIRTEN RPLLQPLRAV PVIGDPLADL IQPNLKVIVN LGYGDPNYGY STSYADVRTP       360
     FGLWPNVPPQ VIADALAAGT QEGILDFTAD LQALSAQPLT LPQIQLPQPA DLVAAVAAAP       420
     TPAEVVNTLA RIISTNYAVL LPTVDIALAL VTTLPLYTTQ LFVRQLAAGN LINAIGYPLA       480
     ATVGLGTIDS GRRGIAHPPR GGLGHRSKHR GPRHLTDSRR HRRPPTTVYR PRQ              533
//

If you have problems or comments...

PBIL Back to PBIL home page