(data stored in ACNUC1104 zone)

EMBL: CP000717.PE158

CP000717.PE158       Location/Qualifiers
FT   CDS             185368..186795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10158"
FT                   /old_locus_tag="TBFG_00156"
FT                   /product="NAD(P) transhydrogenase beta subunit pntB"
FT                   /note="Mapped to H37Rv Rv0157"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10158"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04501"
FT                   /protein_id="ABR04501.1"
FT                   /translation="MNLHYLVEILYIISFSLFIYGLMGLTGPKTAVRGNLIAAAGMTIA
FT                   VAATLVMIRHTSQWPLIIAGLVVGVVLGVPPARLTKMTAMPQLVAFFNGVGGGTVALIA
FT                   LSEFIDTTGFSAFQHGESPTVHIVVASLFAAIIGSISFWGSIVAFGKLQEIISGRPIGL
FT                   GKAQQPINLLLLAVAVAAAVVIGLHAHPGSGGVALWWMIGLLVAAGVLGLMVVLPIGGA
FT                   DMPVVISMLNAMTGLSAAAAGLALNNTAMIVAGMIVGASGSILTNLMAKAMNRSIPAIV
FT                   AGGFGGGGVAPSGGGDDKHVKATSAADAAIQMAYANQVIVVPGYGLAVAQAQHAVKDLA
FT                   TLLEDRGVPVKYAIHPVAGRMPGHMNVLLAEAEVDYDAMKDMDDINDEFARTDVTIVIG
FT                   ANDVTNPAARNETSSPIYGMPILNVDKSRSVIVLKRSMNSGFAGIDNPLFYADGTTMLF
FT                   GDAKKSVTEVSEELKAL"
     MNLHYLVEIL YIISFSLFIY GLMGLTGPKT AVRGNLIAAA GMTIAVAATL VMIRHTSQWP        60
     LIIAGLVVGV VLGVPPARLT KMTAMPQLVA FFNGVGGGTV ALIALSEFID TTGFSAFQHG       120
     ESPTVHIVVA SLFAAIIGSI SFWGSIVAFG KLQEIISGRP IGLGKAQQPI NLLLLAVAVA       180
     AAVVIGLHAH PGSGGVALWW MIGLLVAAGV LGLMVVLPIG GADMPVVISM LNAMTGLSAA       240
     AAGLALNNTA MIVAGMIVGA SGSILTNLMA KAMNRSIPAI VAGGFGGGGV APSGGGDDKH       300
     VKATSAADAA IQMAYANQVI VVPGYGLAVA QAQHAVKDLA TLLEDRGVPV KYAIHPVAGR       360
     MPGHMNVLLA EAEVDYDAMK DMDDINDEFA RTDVTIVIGA NDVTNPAARN ETSSPIYGMP       420
     ILNVDKSRSV IVLKRSMNSG FAGIDNPLFY ADGTTMLFGD AKKSVTEVSE ELKAL            475
//

If you have problems or comments...

PBIL Back to PBIL home page