(data stored in ACNUC1104 zone)

EMBL: CP000717.PE160

CP000717.PE160       Location/Qualifiers
FT   CDS             complement(187749..189155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10160"
FT                   /old_locus_tag="TBFG_00158"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0159c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10160"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04503"
FT                   /protein_id="ABR04503.1"
FT                   /translation="MSYVIAAPEMLATAAADVDGIGSAIRAASASAAGPTTGLLAAAAD
FT                   EVSSAAAALFSEYARECQEVLKQAAAFHGEFTRALAAAGAAYAQAEASNTAAMSGTAGS
FT                   SGALGSVGMLSGNPLTALMMGGTGEPILSDRVLAIIDSAYIRPIFGPNNPVAQYTPEQW
FT                   WPFIGNLSLDQSIAQGVTLLNNGINAELQNGHDVVVFGYSQSAAVATNEIRALMALPPG
FT                   QAPDPSRLAFTLIGNINNPNGGVLERYVGLYLPFLDMSFNGATPPDSPYQTYMYTGQYD
FT                   GYAHNPQYPLNILSDLNAFMGIRWVHNAYPFTAAEVANAVPLPTSPGYTGNTHYYMFLT
FT                   QDLPLLQPIRAIPFVGTPIAELIQPDLRVLVDLGYGYGYADVPTPASLFAPINPIAVAS
FT                   ALATGTVQGPQAALVSIGLLPQSALPNTYPYLPSANPGLMFNFGQSSVTELSVLSGALG
FT                   SVARLIPPIA"
     MSYVIAAPEM LATAAADVDG IGSAIRAASA SAAGPTTGLL AAAADEVSSA AAALFSEYAR        60
     ECQEVLKQAA AFHGEFTRAL AAAGAAYAQA EASNTAAMSG TAGSSGALGS VGMLSGNPLT       120
     ALMMGGTGEP ILSDRVLAII DSAYIRPIFG PNNPVAQYTP EQWWPFIGNL SLDQSIAQGV       180
     TLLNNGINAE LQNGHDVVVF GYSQSAAVAT NEIRALMALP PGQAPDPSRL AFTLIGNINN       240
     PNGGVLERYV GLYLPFLDMS FNGATPPDSP YQTYMYTGQY DGYAHNPQYP LNILSDLNAF       300
     MGIRWVHNAY PFTAAEVANA VPLPTSPGYT GNTHYYMFLT QDLPLLQPIR AIPFVGTPIA       360
     ELIQPDLRVL VDLGYGYGYA DVPTPASLFA PINPIAVASA LATGTVQGPQ AALVSIGLLP       420
     QSALPNTYPY LPSANPGLMF NFGQSSVTEL SVLSGALGSV ARLIPPIA                    468
//

If you have problems or comments...

PBIL Back to PBIL home page