(data stored in ACNUC1104 zone)

EMBL: CP000717.PE161

CP000717.PE161       Location/Qualifiers
FT   CDS             complement(189247..190755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10161"
FT                   /old_locus_tag="TBFG_00159"
FT                   /product="PE family protein"
FT                   /note="Mapped to H37Rv Rv0160c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10161"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04504"
FT                   /protein_id="ABR04504.1"
FT                   /translation="MSHLVTAPDMLATAAAHVDEIASTLRAANAAAAGPTCNLLAAAGD
FT                   EVSAATAALFSAYGREYQAVVKQAAAFHSEFTRTLEAAGNAYAHAEAANAARVSHALDT
FT                   INAPIRTLLGRAPLSPNGSSGAGGLPAIAQLAAESPITALIMGGTNNPLPDPEYVTDIN
FT                   KAFIQTLFPGAVSQGLFTPEQFWPVTPDLGNLTFNQSVTEGVALLNTAVNNQLALDNKV
FT                   VAFGYSQSATIINNYINSLMAMGSPNPDDISFVMIGSGNNPVGGLLARFPGFYIPFLDV
FT                   PFNGATPANSPYPTHIYTAQYDGIAHAPQFPLRILSDINAFMGYFYVHNTYPELMATQV
FT                   DNAVPLPTSPGYTGNTQYYMFLTQDLPLLQPIRDIPYAGPPIADLFQPQLRVLVDLGYA
FT                   DYGPGGNYADIPTPAGLFSIPNPFAVTYYLIKGSLQAPYGAIVEIGVEAGLIGPEWFPD
FT                   SYPWVPSINPGLNFYFGQPQVTLLSLMSGGLGNILHLIPPPVFT"
     MSHLVTAPDM LATAAAHVDE IASTLRAANA AAAGPTCNLL AAAGDEVSAA TAALFSAYGR        60
     EYQAVVKQAA AFHSEFTRTL EAAGNAYAHA EAANAARVSH ALDTINAPIR TLLGRAPLSP       120
     NGSSGAGGLP AIAQLAAESP ITALIMGGTN NPLPDPEYVT DINKAFIQTL FPGAVSQGLF       180
     TPEQFWPVTP DLGNLTFNQS VTEGVALLNT AVNNQLALDN KVVAFGYSQS ATIINNYINS       240
     LMAMGSPNPD DISFVMIGSG NNPVGGLLAR FPGFYIPFLD VPFNGATPAN SPYPTHIYTA       300
     QYDGIAHAPQ FPLRILSDIN AFMGYFYVHN TYPELMATQV DNAVPLPTSP GYTGNTQYYM       360
     FLTQDLPLLQ PIRDIPYAGP PIADLFQPQL RVLVDLGYAD YGPGGNYADI PTPAGLFSIP       420
     NPFAVTYYLI KGSLQAPYGA IVEIGVEAGL IGPEWFPDSY PWVPSINPGL NFYFGQPQVT       480
     LLSLMSGGLG NILHLIPPPV FT                                                502
//

If you have problems or comments...

PBIL Back to PBIL home page