(data stored in ACNUC1104 zone)

EMBL: CP000717.PE163

CP000717.PE163       Location/Qualifiers
FT   CDS             complement(192300..193451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10163"
FT                   /old_locus_tag="TBFG_00161"
FT                   /product="zinc-type alcohol dehydrogenase subunit E adhE"
FT                   /note="Mapped to H37Rv Rv0162c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10163"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04507"
FT                   /protein_id="ABR04507.1"
FT                   /translation="MPAVQPWLYSNMPAIRGAVLDQIGVPRPYWRSKPISVVELHLDPP
FT                   DRGEVLVRIEAAGVCHSDLSVVDGTRVRPVPILLGHEAAGIVEQVGDGVDGVAVGQRVV
FT                   LVFLPRCGQCAACATDGRTPCEPGSAANKAGTLLGGGIRLSRGGRPVYHHLGVSGFATH
FT                   VVVNRASVVPVPHEVPPTVAALLGCAVLTGGGAVLNVGDPQPGQSVAVVGLGGVGMAAV
FT                   LTALTYTDVRVVAVDQLPEKLSAAKALGAHEIYTPQQATAGGVKAAVVVEAVGHPAALH
FT                   TAIGLTAPGGRTITVGLPPPDVRISLSPLDFVTEGRSLIGSYLGSAVPSHDIPRFVSLW
FT                   QSGRLPVESLVTSTIRLDDINEAMDHLADGIAVRQLISFTGDL"
     MPAVQPWLYS NMPAIRGAVL DQIGVPRPYW RSKPISVVEL HLDPPDRGEV LVRIEAAGVC        60
     HSDLSVVDGT RVRPVPILLG HEAAGIVEQV GDGVDGVAVG QRVVLVFLPR CGQCAACATD       120
     GRTPCEPGSA ANKAGTLLGG GIRLSRGGRP VYHHLGVSGF ATHVVVNRAS VVPVPHEVPP       180
     TVAALLGCAV LTGGGAVLNV GDPQPGQSVA VVGLGGVGMA AVLTALTYTD VRVVAVDQLP       240
     EKLSAAKALG AHEIYTPQQA TAGGVKAAVV VEAVGHPAAL HTAIGLTAPG GRTITVGLPP       300
     PDVRISLSPL DFVTEGRSLI GSYLGSAVPS HDIPRFVSLW QSGRLPVESL VTSTIRLDDI       360
     NEAMDHLADG IAVRQLISFT GDL                                               383
//

If you have problems or comments...

PBIL Back to PBIL home page