(data stored in ACNUC1104 zone)

EMBL: CP000717.PE164

CP000717.PE164       Location/Qualifiers
FT   CDS             193433..193888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10164"
FT                   /old_locus_tag="TBFG_00162"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0163"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10164"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04506"
FT                   /protein_id="ABR04506.1"
FT                   /translation="MAALPAPEKLLRSDFPVLWPVGTRWADNDMFGHLNNAVYYQLFDT
FT                   AINAWINTSTGVDPLAMPVLGIVAESGCRYFSELRFPESLMVGLAVTRLGRSSVTYRLG
FT                   VFKEPDDAGVITALGHWVHVYVDRTSRRPVPIPEAIRSLLSTACVSG"
     MAALPAPEKL LRSDFPVLWP VGTRWADNDM FGHLNNAVYY QLFDTAINAW INTSTGVDPL        60
     AMPVLGIVAE SGCRYFSELR FPESLMVGLA VTRLGRSSVT YRLGVFKEPD DAGVITALGH       120
     WVHVYVDRTS RRPVPIPEAI RSLLSTACVS G                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page