(data stored in ACNUC1104 zone)

EMBL: CP000717.PE168

CP000717.PE168       Location/Qualifiers
FT   CDS             197177..197974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10168"
FT                   /old_locus_tag="TBFG_00166"
FT                   /product="hypothetical integral membrane protein yrbE1A"
FT                   /note="Mapped to H37Rv Rv0167"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10168"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04511"
FT                   /protein_id="ABR04511.1"
FT                   /translation="MTTSTTLGGYVRDQLQTPLTLVGGFFRMCVLTGKALFRWPFQWRE
FT                   FILQCWFIMRVGFLPTIMVSIPLTVLLIFTLNILLAQFGAADISGSGAAIGAVTQLGPL
FT                   TTVLVVAGAGSTAICADLGARTIREEIDAMEVLGIDPIHRLVVPRVLASMLVATLLNGL
FT                   VITVGLVGGFLFGVYLQNVSGGAYLATLTLITGLPEVVIATIKAATFGLIAGLVGCYRG
FT                   LTVRGGSKGLGTAVNETVVLCVIALFAVNVILTTIGVRFGTGR"
     MTTSTTLGGY VRDQLQTPLT LVGGFFRMCV LTGKALFRWP FQWREFILQC WFIMRVGFLP        60
     TIMVSIPLTV LLIFTLNILL AQFGAADISG SGAAIGAVTQ LGPLTTVLVV AGAGSTAICA       120
     DLGARTIREE IDAMEVLGID PIHRLVVPRV LASMLVATLL NGLVITVGLV GGFLFGVYLQ       180
     NVSGGAYLAT LTLITGLPEV VIATIKAATF GLIAGLVGCY RGLTVRGGSK GLGTAVNETV       240
     VLCVIALFAV NVILTTIGVR FGTGR                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page