(data stored in ACNUC1104 zone)

EMBL: CP000717.PE17

CP000717.PE17        Location/Qualifiers
FT   CDS             complement(20332..21741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10017"
FT                   /old_locus_tag="TBFG_00017"
FT                   /product="cell division protein rodA"
FT                   /note="Mapped to H37Rv Rv0017c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10017"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04360"
FT                   /protein_id="ABR04360.1"
FT                   /translation="MTTRLQAPVAVTPPLPTRRNAELLLLCFAAVITFAALLVVQANQD
FT                   QGVPWDLTSYGLAFLTLFGSAHLAIRRFAPYTDPLLLPVVALLNGLGLVMIHRLDLVDN
FT                   EIGEHRHPSANQQMLWTLVGVAAFALVVTFLKDHRQLARYGYICGLAGLVFLAVPALLP
FT                   AALSEQNGAKIWIRLPGFSIQPAEFSKILLLIFFSAVLVAKRGLFTSAGKHLLGMTLPR
FT                   PRDLAPLLAAWVISVGVMVFEKDLGASLLLYTSFLVVVYLATQRFSWVVIGLTLFAAGT
FT                   LVAYFIFEHVRLRVQTWLDPFADPDGTGYQIVQSLFSFATGGIFGTGLGNGQPDTVPAA
FT                   STDFIIAAFGEELGLVGLTAILMLYTIVIIRGLRTAIATRDSFGKLLAAGLSSTLAIQL
FT                   FIVVGGVTRLIPLTGLTTPWMSYGGSSLLANYILLAILARISHGARRPLRTRPRNKSPI
FT                   TAAGTEVIERV"
     MTTRLQAPVA VTPPLPTRRN AELLLLCFAA VITFAALLVV QANQDQGVPW DLTSYGLAFL        60
     TLFGSAHLAI RRFAPYTDPL LLPVVALLNG LGLVMIHRLD LVDNEIGEHR HPSANQQMLW       120
     TLVGVAAFAL VVTFLKDHRQ LARYGYICGL AGLVFLAVPA LLPAALSEQN GAKIWIRLPG       180
     FSIQPAEFSK ILLLIFFSAV LVAKRGLFTS AGKHLLGMTL PRPRDLAPLL AAWVISVGVM       240
     VFEKDLGASL LLYTSFLVVV YLATQRFSWV VIGLTLFAAG TLVAYFIFEH VRLRVQTWLD       300
     PFADPDGTGY QIVQSLFSFA TGGIFGTGLG NGQPDTVPAA STDFIIAAFG EELGLVGLTA       360
     ILMLYTIVII RGLRTAIATR DSFGKLLAAG LSSTLAIQLF IVVGGVTRLI PLTGLTTPWM       420
     SYGGSSLLAN YILLAILARI SHGARRPLRT RPRNKSPITA AGTEVIERV                   469
//

If you have problems or comments...

PBIL Back to PBIL home page