(data stored in ACNUC1104 zone)

EMBL: CP000717.PE172

CP000717.PE172       Location/Qualifiers
FT   CDS             201248..202795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10172"
FT                   /old_locus_tag="TBFG_00170"
FT                   /product="MCE-family protein mce1C"
FT                   /note="Mapped to H37Rv Rv0171"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10172"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04515"
FT                   /protein_id="ABR04515.1"
FT                   /translation="MRTLEPPNRMRIGLMGIVVALLVVAVGQSFTSVPMLFAKPSYYGQ
FT                   FTDSGGLHKGDRVRIAGLGVGTVEGLKIDGDHIVVKFSIGTNTIGTESRLAIRTDTILG
FT                   RKVLEIEPRGAQALPPGGVLPVGQSTTPYQIYDAFFDVTKAASGWDIETVKRSLNVLSE
FT                   TVDQTYPHLSAALDGVAKFSDTIGKRDEQITHLLAQANQVASILGDRSEQVDRLLVNAK
FT                   TLIAAFNERGRAVDALLGNISAFSAQVQNLINDNPNLNHVLEQLRILTDLLVDRKEDLA
FT                   ETLTILGRFSASFGETFASGPYFKVLLANLVPGQILQPFVDAAFKKRGISPEDFWRSAG
FT                   LPAYRWPDPNGTRFPNGAPPPPPPVLEGTPEHPGPAVPPGSPCSYTPPADGLPRPWDPL
FT                   PCANLTQGPFGGPDFPAPLDVATSPPNPDGPPPAPGLPIAGRPGEVPPNVPGTPVPIPQ
FT                   EAPPGARTLPLGPAPGPAPPPAAPGPPAPPGPGPQLPAPFINPGGTGGSGVTGGSEN"
     MRTLEPPNRM RIGLMGIVVA LLVVAVGQSF TSVPMLFAKP SYYGQFTDSG GLHKGDRVRI        60
     AGLGVGTVEG LKIDGDHIVV KFSIGTNTIG TESRLAIRTD TILGRKVLEI EPRGAQALPP       120
     GGVLPVGQST TPYQIYDAFF DVTKAASGWD IETVKRSLNV LSETVDQTYP HLSAALDGVA       180
     KFSDTIGKRD EQITHLLAQA NQVASILGDR SEQVDRLLVN AKTLIAAFNE RGRAVDALLG       240
     NISAFSAQVQ NLINDNPNLN HVLEQLRILT DLLVDRKEDL AETLTILGRF SASFGETFAS       300
     GPYFKVLLAN LVPGQILQPF VDAAFKKRGI SPEDFWRSAG LPAYRWPDPN GTRFPNGAPP       360
     PPPPVLEGTP EHPGPAVPPG SPCSYTPPAD GLPRPWDPLP CANLTQGPFG GPDFPAPLDV       420
     ATSPPNPDGP PPAPGLPIAG RPGEVPPNVP GTPVPIPQEA PPGARTLPLG PAPGPAPPPA       480
     APGPPAPPGP GPQLPAPFIN PGGTGGSGVT GGSEN                                  515
//

If you have problems or comments...

PBIL Back to PBIL home page