(data stored in ACNUC1104 zone)

EMBL: CP000717.PE177

CP000717.PE177       Location/Qualifiers
FT   CDS             207768..208736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10177"
FT                   /old_locus_tag="TBFG_00175"
FT                   /product="MCE associated membrane protein"
FT                   /note="Mapped to H37Rv Rv0176"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10177"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04520"
FT                   /protein_id="ABR04520.1"
FT                   /translation="MTVVVEKTPTTLPQATPNGAAPWHVRAGAFAIDVLPGLAVAATMA
FT                   LTALTVPPGSAWRWLCACLLGLTILLLAVNRLLLPTITGWSLGRALTGIRVVRRDGSAI
FT                   GPWRLLVRDLAHLVDTLSLFVGWLWPLWDSRRRTFADLLLRTEVRRVEPVQRPAVIRRL
FT                   TAAVALAAAGACASATAVGAAVVYVNEWQTDHTRAQLATRGPKLVVDVLSYDPETVQRD
FT                   FERARSLATDRYRPQLSIQQDSVRESGPVRNQYWVTDSAVLSATPAQATMLLFMQGERG
FT                   TPPNQRYIQSTVRAIFQKSRGQWRLDDLAVVMKPRQPTGEK"
     MTVVVEKTPT TLPQATPNGA APWHVRAGAF AIDVLPGLAV AATMALTALT VPPGSAWRWL        60
     CACLLGLTIL LLAVNRLLLP TITGWSLGRA LTGIRVVRRD GSAIGPWRLL VRDLAHLVDT       120
     LSLFVGWLWP LWDSRRRTFA DLLLRTEVRR VEPVQRPAVI RRLTAAVALA AAGACASATA       180
     VGAAVVYVNE WQTDHTRAQL ATRGPKLVVD VLSYDPETVQ RDFERARSLA TDRYRPQLSI       240
     QQDSVRESGP VRNQYWVTDS AVLSATPAQA TMLLFMQGER GTPPNQRYIQ STVRAIFQKS       300
     RGQWRLDDLA VVMKPRQPTG EK                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page