(data stored in ACNUC1104 zone)

EMBL: CP000717.PE179

CP000717.PE179       Location/Qualifiers
FT   CDS             209254..209988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10179"
FT                   /old_locus_tag="TBFG_00177"
FT                   /product="MCE associated membrane protein"
FT                   /note="Mapped to H37Rv Rv0178"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10179"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04522"
FT                   /protein_id="ABR04522.1"
FT                   /translation="MEDQQSASGDLTQKSVANGESTDTASAATEGHRGEIDAAGEPDER
FT                   GAAVADSQADEDDSAATAARGGKTRARRSRGRRLAITVGVAAALFVGSAAFAGATVEPY
FT                   LSERAVVATKLMVARTAANAITTLWTYTPENMDTLADRAANYLSGDFAAQYRRFVDQIA
FT                   AANKQAKITNDTEVTGAAVESLSGRDAVAIVYTNTTTTSPVTKNIPALKYLSYRLFMKR
FT                   YDARWLVTRMTTITSLDLTPQV"
     MEDQQSASGD LTQKSVANGE STDTASAATE GHRGEIDAAG EPDERGAAVA DSQADEDDSA        60
     ATAARGGKTR ARRSRGRRLA ITVGVAAALF VGSAAFAGAT VEPYLSERAV VATKLMVART       120
     AANAITTLWT YTPENMDTLA DRAANYLSGD FAAQYRRFVD QIAAANKQAK ITNDTEVTGA       180
     AVESLSGRDA VAIVYTNTTT TSPVTKNIPA LKYLSYRLFM KRYDARWLVT RMTTITSLDL       240
     TPQV                                                                    244
//

If you have problems or comments...

PBIL Back to PBIL home page