(data stored in ACNUC1104 zone)

EMBL: CP000717.PE19

CP000717.PE19        Location/Qualifiers
FT   CDS             complement(23371..23838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10019"
FT                   /old_locus_tag="TBFG_00019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0019c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10019"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04362"
FT                   /protein_id="ABR04362.1"
FT                   /translation="MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGL
FT                   ALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRH
FT                   ARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP"
     MQGLVLQLTR AGFLMLLWVF IWSVLRILKT DIYAPTGAVM MRRGLALRGT LLGARQRRHA        60
     ARYLVVTEGA LTGARITLSE QPVLIGRADD STLVLTDDYA STRHARLSMR GSEWYVEDLG       120
     STNGTYLDRA KVTTAVRVPI GTPVRIGKTA IELRP                                  155
//

If you have problems or comments...

PBIL Back to PBIL home page