(data stored in ACNUC1104 zone)

EMBL: CP000717.PE192

CP000717.PE192       Location/Qualifiers
FT   CDS             222605..223846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10192"
FT                   /old_locus_tag="TBFG_00190"
FT                   /product="conserved integral membrane protein"
FT                   /note="Mapped to H37Rv Rv0191"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10192"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04535"
FT                   /protein_id="ABR04535.1"
FT                   /translation="MTAPTGTSATTTRPWTPRIATQLSVLACAAFIYVTAEILPVGALS
FT                   AIARNLRVSVVLVGTLLSWYALVAAVTTVPLVRWTAHWPRRRALVVSLVCLTVSQLVSA
FT                   LAPNFAVLAAGRVLCAVTHGLLWAVIAPIATRLVPPSHAGRATTSIYIGTSLALVVGSP
FT                   LTAAMSLMWGWRLAAVCVTGAAAAVALAARLALPEMVLRADQLEHVGRRARHHRNPRLV
FT                   KVSVLTMIAVTGHFVSYTYIVVIIRDVVGVRGPNLAWLLAAYGVAGLVSVPLVARPLDR
FT                   WPKGAVIVGMTGLTAAFTLLTALAFGERHTAATALLGTGAIVLWGALATAVSPMLQSAA
FT                   MRSGGDDPDGASGLYVTAFQIGIMAGALLGGLLYERSLAMMLTASAGLMGVALFGMTVS
FT                   QHLFENPTLSPGDG"
     MTAPTGTSAT TTRPWTPRIA TQLSVLACAA FIYVTAEILP VGALSAIARN LRVSVVLVGT        60
     LLSWYALVAA VTTVPLVRWT AHWPRRRALV VSLVCLTVSQ LVSALAPNFA VLAAGRVLCA       120
     VTHGLLWAVI APIATRLVPP SHAGRATTSI YIGTSLALVV GSPLTAAMSL MWGWRLAAVC       180
     VTGAAAAVAL AARLALPEMV LRADQLEHVG RRARHHRNPR LVKVSVLTMI AVTGHFVSYT       240
     YIVVIIRDVV GVRGPNLAWL LAAYGVAGLV SVPLVARPLD RWPKGAVIVG MTGLTAAFTL       300
     LTALAFGERH TAATALLGTG AIVLWGALAT AVSPMLQSAA MRSGGDDPDG ASGLYVTAFQ       360
     IGIMAGALLG GLLYERSLAM MLTASAGLMG VALFGMTVSQ HLFENPTLSP GDG              413
//

If you have problems or comments...

PBIL Back to PBIL home page