(data stored in ACNUC1104 zone)

EMBL: CP000717.PE195

CP000717.PE195       Location/Qualifiers
FT   CDS             complement(225040..226887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10195"
FT                   /old_locus_tag="TBFG_00192"
FT                   /product="hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0193c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10195"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04538"
FT                   /protein_id="ABR04538.1"
FT                   /translation="MIQISRDMSSLGQTATTQALPDNSDGIQLTKFAADDILPLEYAPP
FT                   IGPELVSQDQLPAAWAYKRFRDLDDKESYRRKLLQELTDALAAQGSEAAEIATAALRDL
FT                   IDQMAEQGAVVLADIVESDDFLELVKRYDELMAREGSRSFIHRFLDLRRSPGMLTDPAV
FT                   NGALVHPLMIALISYAVGGPIRMIDARGKDAEPLSVLAQDNMLHIDNTPFNDEYKILIT
FT                   WRRGTAQGPAGQNFTFLPGTHKLARTCFVNEDGVPWSSENASIFTTPDSIRKVFDAQRQ
FT                   LGGQDHPTVIEVTDSERPLSGVFAAGSLVHHRFRTASGSARSCIILVFHRVADNPGRMV
FT                   SDVEDSSDVSLSELLTRGVPDESYQQRFIATLCAAADEIAELLLKWKKTPQRPVSLPLQ
FT                   TKQIDGARFEEWISAATEAPEVREIRNRELTIPYGEVLSAEEFFDLIWRLMRFDKHGPL
FT                   DLILYHDNREEPRKWARNLIREMSADRLYERLLGWLADIQQPRPADCLRPLQIHALISE
FT                   VLKTLPLDEDQDPPADWHFDLLGMSHAEAARSVKHLLEDVAEALLRCEDMAAYLSTSLF
FT                   AFWAVDAAYSLDGRRNLVVKDCARRLLRHYTMLSLTCFQ"
     MIQISRDMSS LGQTATTQAL PDNSDGIQLT KFAADDILPL EYAPPIGPEL VSQDQLPAAW        60
     AYKRFRDLDD KESYRRKLLQ ELTDALAAQG SEAAEIATAA LRDLIDQMAE QGAVVLADIV       120
     ESDDFLELVK RYDELMAREG SRSFIHRFLD LRRSPGMLTD PAVNGALVHP LMIALISYAV       180
     GGPIRMIDAR GKDAEPLSVL AQDNMLHIDN TPFNDEYKIL ITWRRGTAQG PAGQNFTFLP       240
     GTHKLARTCF VNEDGVPWSS ENASIFTTPD SIRKVFDAQR QLGGQDHPTV IEVTDSERPL       300
     SGVFAAGSLV HHRFRTASGS ARSCIILVFH RVADNPGRMV SDVEDSSDVS LSELLTRGVP       360
     DESYQQRFIA TLCAAADEIA ELLLKWKKTP QRPVSLPLQT KQIDGARFEE WISAATEAPE       420
     VREIRNRELT IPYGEVLSAE EFFDLIWRLM RFDKHGPLDL ILYHDNREEP RKWARNLIRE       480
     MSADRLYERL LGWLADIQQP RPADCLRPLQ IHALISEVLK TLPLDEDQDP PADWHFDLLG       540
     MSHAEAARSV KHLLEDVAEA LLRCEDMAAY LSTSLFAFWA VDAAYSLDGR RNLVVKDCAR       600
     RLLRHYTMLS LTCFQ                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page