(data stored in ACNUC1104 zone)

EMBL: CP000717.PE198

CP000717.PE198       Location/Qualifiers
FT   CDS             231963..232547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10198"
FT                   /old_locus_tag="TBFG_00195"
FT                   /product="hypothetical transcriptional regulatory protein"
FT                   /note="Mapped to H37Rv Rv0196"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10198"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04541"
FT                   /protein_id="ABR04541.1"
FT                   /translation="MQGPRERMVVSAALLIRERGAHATAISDVLQHSGAPRGSAYHYFP
FT                   GGRTQLLCEAVDYAGEHVAAMINEAEGGLELLDALIDKYRQQLLSTDFRAGCPIAAVSV
FT                   EAGDEQDRERMAPVIARAAAVFDRWSDLTAQRFIADGIPPDRAHELAVLATSTLEGAIL
FT                   LARVRRDLTPLDLVHRQLRNLLLAELPERSR"
     MQGPRERMVV SAALLIRERG AHATAISDVL QHSGAPRGSA YHYFPGGRTQ LLCEAVDYAG        60
     EHVAAMINEA EGGLELLDAL IDKYRQQLLS TDFRAGCPIA AVSVEAGDEQ DRERMAPVIA       120
     RAAAVFDRWS DLTAQRFIAD GIPPDRAHEL AVLATSTLEG AILLARVRRD LTPLDLVHRQ       180
     LRNLLLAELP ERSR                                                         194
//

If you have problems or comments...

PBIL Back to PBIL home page