(data stored in ACNUC1104 zone)

EMBL: CP000717.PE201

CP000717.PE201       Location/Qualifiers
FT   CDS             236868..237527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10201"
FT                   /old_locus_tag="TBFG_00198"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0199"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10201"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04544"
FT                   /protein_id="ABR04544.1"
FT                   /translation="MPDGEQSQPPAQEDAEDDSRPDAAEAAAAEPKSSAGPMFSTYGIA
FT                   STLLGVLSVAAVVLGAMIWSAHRDDSGERTYLTRVMLTAAEWTAVLINMNADNIDASLQ
FT                   RLHDGTVGQLNTDFDAVVQPYRQVVEKLRTHSSGRIEAVAIDTVHRELDTQSGAARPVV
FT                   TTKLPPFATRTDSVLLVATSVSENAGAKPQTVHWNLRLDVSDVDGKLMISRLESIR"
     MPDGEQSQPP AQEDAEDDSR PDAAEAAAAE PKSSAGPMFS TYGIASTLLG VLSVAAVVLG        60
     AMIWSAHRDD SGERTYLTRV MLTAAEWTAV LINMNADNID ASLQRLHDGT VGQLNTDFDA       120
     VVQPYRQVVE KLRTHSSGRI EAVAIDTVHR ELDTQSGAAR PVVTTKLPPF ATRTDSVLLV       180
     ATSVSENAGA KPQTVHWNLR LDVSDVDGKL MISRLESIR                              219
//

If you have problems or comments...

PBIL Back to PBIL home page