(data stored in ACNUC1104 zone)

EMBL: CP000717.PE202

CP000717.PE202       Location/Qualifiers
FT   CDS             237524..238213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10202"
FT                   /old_locus_tag="TBFG_00199"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0200"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10202"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04545"
FT                   /protein_id="ABR04545.1"
FT                   /translation="MRNAWRLVVFDVLAPLATIAALAAIGVLLGWPLWWVSTCSVLVLL
FT                   VVEGVAINFWLLRRDSVTVGTDDDAPGLRLAVVFLCAAAISAAVVTGYLRWTTPDRDFN
FT                   RDSREVVHLATGMAETVASFSPSAPAAAVDRAAAMMVPEHAGGFKEQYAKSSADLARRG
FT                   VTAQAATLAAGVEAIGPSAASVAVILRVSQSIPGQPTSQAARALRVTLTKRGSGWLVLD
FT                   VTPINAR"
     MRNAWRLVVF DVLAPLATIA ALAAIGVLLG WPLWWVSTCS VLVLLVVEGV AINFWLLRRD        60
     SVTVGTDDDA PGLRLAVVFL CAAAISAAVV TGYLRWTTPD RDFNRDSREV VHLATGMAET       120
     VASFSPSAPA AAVDRAAAMM VPEHAGGFKE QYAKSSADLA RRGVTAQAAT LAAGVEAIGP       180
     SAASVAVILR VSQSIPGQPT SQAARALRVT LTKRGSGWLV LDVTPINAR                   229
//

If you have problems or comments...

PBIL Back to PBIL home page