(data stored in ACNUC1104 zone)

EMBL: CP000717.PE204

CP000717.PE204       Location/Qualifiers
FT   CDS             complement(238710..241610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10204"
FT                   /old_locus_tag="TBFG_00201"
FT                   /product="transmembrane transport protein mmpL11"
FT                   /note="Mapped to H37Rv Rv0202c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10204"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04547"
FT                   /protein_id="ABR04547.1"
FT                   /translation="MMRLSRNLRRCRWLVFTGWLLALVPAVYLAMTQSGNLTGGGFEVA
FT                   GSQSLLVHDQLDAHYPDRGAPALALVAAPRPDASYQDIDNAVALLRQIASELPGVTEAP
FT                   NPTQRPPQPDRPYVVSLRLDARNAGTSDVAKKLRDRIGVKGDQSGQTANGKVRLYVIGQ
FT                   GALSAAAAANTKHDIANAERWNLPIILMVLVAVFGSLAAAAIPLALAVCTVVITMGLVF
FT                   VLSMHTTMSVFVTSTVSMFGIALAVDYSLFILMRYREELRCGRRPPDAVDAAMATSGLA
FT                   VVLSGMTVIASLTGIYLINTPALRSMATGAILAVAVAMLTSATLTPAVLATFARAAAKR
FT                   SALVHWSRRPASTQSWFWSRWVGWVMRRPWITALAASTVLLVMAAPATLMVLGNSLLRQ
FT                   FDSSHEIRTGAAAAAQALGPGALGPVQVLVRFDAGGASAPEHSQTIAAIRHRIAQAPNV
FT                   VSVAPPRFADDNGSALLSAVLSVDPEDLGARDTITWMRTQLPRVAGAAQVDVGGPTALI
FT                   KDFDDRVSATQPLVLVFVAVIAFLMLLISIRSVFLAFKGVLMTLLSVAAAYGSLVMVFQ
FT                   WGWARGLGFPALHSIDSTVPPLVLAMTFGLSMDYEIFLLTRIRERFLQTGQTRDAVAYG
FT                   VRTSARTITSAALIMIAVFCGFAFAGMPLVAEIGVACAVAIAVDATVVRLVLVPALMAM
FT                   FDRWNWWLPRWLAHILPSVDFDRPLPKVDLGDVVVIPDDFAAAIPPSADVRMVLKSAAK
FT                   LKRLAPDAICVTDPLAFTGCGCDGKALDQVQLAYRNGIARAISWGQRPVHPVTVWRKRL
FT                   AVALDALQTTTWECGGVQTHRAGPGYRRRSPVETTNVALPTGDRLQIPTGAETLRFKGY
FT                   LIMSRNSSHDYADFADLVDTMAPETAAAVLAGMDRYYSCQAPGRQWMATQLVGRLADPQ
FT                   PSDLGDQSPGADAQAKWEEVRRRCLSVAVAMLEEAR"
     MMRLSRNLRR CRWLVFTGWL LALVPAVYLA MTQSGNLTGG GFEVAGSQSL LVHDQLDAHY        60
     PDRGAPALAL VAAPRPDASY QDIDNAVALL RQIASELPGV TEAPNPTQRP PQPDRPYVVS       120
     LRLDARNAGT SDVAKKLRDR IGVKGDQSGQ TANGKVRLYV IGQGALSAAA AANTKHDIAN       180
     AERWNLPIIL MVLVAVFGSL AAAAIPLALA VCTVVITMGL VFVLSMHTTM SVFVTSTVSM       240
     FGIALAVDYS LFILMRYREE LRCGRRPPDA VDAAMATSGL AVVLSGMTVI ASLTGIYLIN       300
     TPALRSMATG AILAVAVAML TSATLTPAVL ATFARAAAKR SALVHWSRRP ASTQSWFWSR       360
     WVGWVMRRPW ITALAASTVL LVMAAPATLM VLGNSLLRQF DSSHEIRTGA AAAAQALGPG       420
     ALGPVQVLVR FDAGGASAPE HSQTIAAIRH RIAQAPNVVS VAPPRFADDN GSALLSAVLS       480
     VDPEDLGARD TITWMRTQLP RVAGAAQVDV GGPTALIKDF DDRVSATQPL VLVFVAVIAF       540
     LMLLISIRSV FLAFKGVLMT LLSVAAAYGS LVMVFQWGWA RGLGFPALHS IDSTVPPLVL       600
     AMTFGLSMDY EIFLLTRIRE RFLQTGQTRD AVAYGVRTSA RTITSAALIM IAVFCGFAFA       660
     GMPLVAEIGV ACAVAIAVDA TVVRLVLVPA LMAMFDRWNW WLPRWLAHIL PSVDFDRPLP       720
     KVDLGDVVVI PDDFAAAIPP SADVRMVLKS AAKLKRLAPD AICVTDPLAF TGCGCDGKAL       780
     DQVQLAYRNG IARAISWGQR PVHPVTVWRK RLAVALDALQ TTTWECGGVQ THRAGPGYRR       840
     RSPVETTNVA LPTGDRLQIP TGAETLRFKG YLIMSRNSSH DYADFADLVD TMAPETAAAV       900
     LAGMDRYYSC QAPGRQWMAT QLVGRLADPQ PSDLGDQSPG ADAQAKWEEV RRRCLSVAVA       960
     MLEEAR                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page