(data stored in ACNUC1104 zone)

EMBL: CP000717.PE205

CP000717.PE205       Location/Qualifiers
FT   CDS             241832..242242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10205"
FT                   /old_locus_tag="TBFG_00202"
FT                   /product="hypothetical exported protein"
FT                   /note="Mapped to H37Rv Rv0203"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10205"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04548"
FT                   /protein_id="ABR04548.1"
FT                   /translation="MKTGTATTRRRLLAVLIALALPGAAVALLAEPSATGASDPCAASE
FT                   VARTVGSVAKSMGDYLDSHPETNQVMTAVLQQQVGPGSVASLKAHFEANPKVASDLHAL
FT                   SQPLTDLSTRCSLPISGLQAIGLMQAVQGARR"
     MKTGTATTRR RLLAVLIALA LPGAAVALLA EPSATGASDP CAASEVARTV GSVAKSMGDY        60
     LDSHPETNQV MTAVLQQQVG PGSVASLKAH FEANPKVASD LHALSQPLTD LSTRCSLPIS       120
     GLQAIGLMQA VQGARR                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page