(data stored in ACNUC1104 zone)

EMBL: CP000717.PE208

CP000717.PE208       Location/Qualifiers
FT   CDS             complement(244802..247636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10208"
FT                   /old_locus_tag="TBFG_00205"
FT                   /product="transmembrane transport protein mmpL3"
FT                   /note="Mapped to H37Rv Rv0206c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10208"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04551"
FT                   /protein_id="ABR04551.1"
FT                   /translation="MFAWWGRTVYRYRFIVIGVMVALCLGGGVFGLSLGKHVTQSGFYD
FT                   DGSQSVQASVLGDQVYGRDRSGHIVAIFQAPAGKTVDDPAWSKKVVDELNRFQQDHPDQ
FT                   VLGWAGYLRASQATGMATADKKYTFVSIPLKGDDDDTILNNYKAIAPDLQRLDGGTVKL
FT                   AGLQPVAEALTGTIATDQRRMEVLALPLVAVVLFFVFGGVIAAGLPVMVGGLCIAGALG
FT                   IMRFLAIFGPVHYFAQPVVSLIGLGIAIDYGLFIVSRFREEIAEGYDTETAVRRTVITA
FT                   GRTVTFSAVLIVASAIGLLLFPQGFLKSLTYATIASVMLSAILSITVLPACLGILGKHV
FT                   DALGVRTLFRVPFLANWKISAAYLNWLADRLQRTKTREEVEAGFWGKLVNRVMKRPVLF
FT                   AAPIVIIMILLIIPVGKLSLGGISEKYLPPTNSVRQAQEEFDKLFPGYRTNPLTLVIQT
FT                   SNHQPVTDAQIADIRSKAMAIGGFIEPDNDPANMWQERAYAVGASKDPSVRVLQNGLIN
FT                   PADASKKLTELRAITPPKGITVLVGGTPALELDSIHGLFAKMPLMVVILLTTTIVLMFL
FT                   AFGSVVLPIKATLMSALTLGSTMGILTWIFVDGHFSKWLNFTPTPLTAPVIGLIIALVF
FT                   GLSTDYEVFLVSRMVEARERGMSTQEAIRIGTAATGRIITAAALIVAVVAGAFVFSDLV
FT                   MMKYLAFGLMAALLLDATVVRMFLVPSVMKLLGDDCWWAPRWARRLQTRIGLGEIHLPD
FT                   ERKRPVSNGRPARPPVTAGLVAARAAGDPRPPHDPTHPLAESPRPARSSRASSPELTPA
FT                   LEATAAPAAPSGASTTRMQIGSSTEPPTTRLAAAGRSVQSPASTPPPTPTPPSALSAGQ
FT                   TRAMPLAANRSTDAAGDPAEPTAALPIIRSDGDDSEAATEQLNARGTSDKTRQRRRGGG
FT                   ALSAQDLLRREGRL"
     MFAWWGRTVY RYRFIVIGVM VALCLGGGVF GLSLGKHVTQ SGFYDDGSQS VQASVLGDQV        60
     YGRDRSGHIV AIFQAPAGKT VDDPAWSKKV VDELNRFQQD HPDQVLGWAG YLRASQATGM       120
     ATADKKYTFV SIPLKGDDDD TILNNYKAIA PDLQRLDGGT VKLAGLQPVA EALTGTIATD       180
     QRRMEVLALP LVAVVLFFVF GGVIAAGLPV MVGGLCIAGA LGIMRFLAIF GPVHYFAQPV       240
     VSLIGLGIAI DYGLFIVSRF REEIAEGYDT ETAVRRTVIT AGRTVTFSAV LIVASAIGLL       300
     LFPQGFLKSL TYATIASVML SAILSITVLP ACLGILGKHV DALGVRTLFR VPFLANWKIS       360
     AAYLNWLADR LQRTKTREEV EAGFWGKLVN RVMKRPVLFA APIVIIMILL IIPVGKLSLG       420
     GISEKYLPPT NSVRQAQEEF DKLFPGYRTN PLTLVIQTSN HQPVTDAQIA DIRSKAMAIG       480
     GFIEPDNDPA NMWQERAYAV GASKDPSVRV LQNGLINPAD ASKKLTELRA ITPPKGITVL       540
     VGGTPALELD SIHGLFAKMP LMVVILLTTT IVLMFLAFGS VVLPIKATLM SALTLGSTMG       600
     ILTWIFVDGH FSKWLNFTPT PLTAPVIGLI IALVFGLSTD YEVFLVSRMV EARERGMSTQ       660
     EAIRIGTAAT GRIITAAALI VAVVAGAFVF SDLVMMKYLA FGLMAALLLD ATVVRMFLVP       720
     SVMKLLGDDC WWAPRWARRL QTRIGLGEIH LPDERKRPVS NGRPARPPVT AGLVAARAAG       780
     DPRPPHDPTH PLAESPRPAR SSRASSPELT PALEATAAPA APSGASTTRM QIGSSTEPPT       840
     TRLAAAGRSV QSPASTPPPT PTPPSALSAG QTRAMPLAAN RSTDAAGDPA EPTAALPIIR       900
     SDGDDSEAAT EQLNARGTSD KTRQRRRGGG ALSAQDLLRR EGRL                        944
//

If you have problems or comments...

PBIL Back to PBIL home page