(data stored in ACNUC1104 zone)

EMBL: CP000717.PE21

CP000717.PE21        Location/Qualifiers
FT   CDS             complement(26014..26982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10021"
FT                   /old_locus_tag="TBFG_00021"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0021c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10021"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04364"
FT                   /protein_id="ABR04364.1"
FT                   /translation="MVLSTAFSQMFGIDYPIVSAPMDLIAGGELAAAVSGAGGLGLIGG
FT                   GYGDRDWLARQFDLAAGAPVGCGFITWSLARQPQLLDLALQYEPVAVMLSFGDPAVFAD
FT                   AIKSAGTRLVCQIQNRTQAERALQVGADVLVAQGTEAGGHGHGPRSTLTLVPEIVDLVT
FT                   ARGTDIPVIAAGGIADGRGLAAALMLGAAGVLVGTRFYATVEALSTPQARDPLLAATGD
FT                   DMCRTTIYDQLRRYPWPQGHTMSVLSNALTDQFEDTELDILHREEAMARYWRAVAARDY
FT                   SIANVTAGQAAGLVNAVLPAADVITGMAQQAARTLTAMRAV"
     MVLSTAFSQM FGIDYPIVSA PMDLIAGGEL AAAVSGAGGL GLIGGGYGDR DWLARQFDLA        60
     AGAPVGCGFI TWSLARQPQL LDLALQYEPV AVMLSFGDPA VFADAIKSAG TRLVCQIQNR       120
     TQAERALQVG ADVLVAQGTE AGGHGHGPRS TLTLVPEIVD LVTARGTDIP VIAAGGIADG       180
     RGLAAALMLG AAGVLVGTRF YATVEALSTP QARDPLLAAT GDDMCRTTIY DQLRRYPWPQ       240
     GHTMSVLSNA LTDQFEDTEL DILHREEAMA RYWRAVAARD YSIANVTAGQ AAGLVNAVLP       300
     AADVITGMAQ QAARTLTAMR AV                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page