(data stored in ACNUC1104 zone)

EMBL: CP000717.PE218

CP000717.PE218       Location/Qualifiers
FT   CDS             259231..260244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10218"
FT                   /old_locus_tag="TBFG_00215"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0216"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10218"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04561"
FT                   /protein_id="ABR04561.1"
FT                   /translation="MASGYGGIRVGGPYFDDLSKGQVFDWAPGVTLSLGLAAAHQSIVG
FT                   NRLRLALDSDLCAAVTGMPGPLAHPGLVCDVAIGQSTLATQRVKANLFYRGLRFHRFPA
FT                   VGDTLYTRTEVVGLRANSPKPGRAPTGLAGLRMTTIDRTDRLVLDFYRCAMLPASPDWK
FT                   PGAVPGDDLSRIGADAPAPAADPTAHWDGAVFRKRVPGPHFDAGIAGAVLHSTADLVSG
FT                   APELARLTLNIAATHHDWRVSGRRLVYGGHTIGLALAQATRLLPNLATVLDWESCDHTA
FT                   PVHEGDTLYSELHIESAQAHADGGVLGLRSLVYAVSDSASEPDRQVLDWRFSALQF"
     MASGYGGIRV GGPYFDDLSK GQVFDWAPGV TLSLGLAAAH QSIVGNRLRL ALDSDLCAAV        60
     TGMPGPLAHP GLVCDVAIGQ STLATQRVKA NLFYRGLRFH RFPAVGDTLY TRTEVVGLRA       120
     NSPKPGRAPT GLAGLRMTTI DRTDRLVLDF YRCAMLPASP DWKPGAVPGD DLSRIGADAP       180
     APAADPTAHW DGAVFRKRVP GPHFDAGIAG AVLHSTADLV SGAPELARLT LNIAATHHDW       240
     RVSGRRLVYG GHTIGLALAQ ATRLLPNLAT VLDWESCDHT APVHEGDTLY SELHIESAQA       300
     HADGGVLGLR SLVYAVSDSA SEPDRQVLDW RFSALQF                                337
//

If you have problems or comments...

PBIL Back to PBIL home page