(data stored in ACNUC1104 zone)

EMBL: CP000717.PE22

CP000717.PE22        Location/Qualifiers
FT   CDS             complement(27124..27543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10022"
FT                   /old_locus_tag="TBFG_00022"
FT                   /product="transcriptional regulatory protein whib-like
FT                   whiB5"
FT                   /note="Mapped to H37Rv Rv0022c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10022"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04365"
FT                   /protein_id="ABR04365.1"
FT                   /translation="MAHPCATDPELWFGYPDDDGSDGAAKARAYERSATQARIQCLRRC
FT                   PLLQQRRCAQHAVEHRVEYGVWAGIKLPGGQYRKREQLAAAHDVLRRIAGGEINSRQLP
FT                   DNAALLARNEGLEVTPVPGVVVHLPIAQVGPQPAA"
     MAHPCATDPE LWFGYPDDDG SDGAAKARAY ERSATQARIQ CLRRCPLLQQ RRCAQHAVEH        60
     RVEYGVWAGI KLPGGQYRKR EQLAAAHDVL RRIAGGEINS RQLPDNAALL ARNEGLEVTP       120
     VPGVVVHLPI AQVGPQPAA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page