(data stored in ACNUC1104 zone)

EMBL: CP000717.PE220

CP000717.PE220       Location/Qualifiers
FT   CDS             261242..262570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10220"
FT                   /old_locus_tag="TBFG_00217"
FT                   /product="conserved transmembrane protein"
FT                   /note="Mapped to H37Rv Rv0218"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10220"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04563"
FT                   /protein_id="ABR04563.1"
FT                   /translation="MSDPARGAEAEDAYGFPAGLWRWLQRHPPPALHRLTRFRSPLRGP
FT                   WLTSVFGLVLLVALPFVIITGLLSYIAYAPQLGQAIPGDVGWLRLPAFTWPTRPSWLYR
FT                   LTQGLHVGLGLVIIPVVLAKLWSVIPRLFVWPPARSIAQVLERLSVLMLVGGILFQIVT
FT                   GVLNIQYDYIFGFSFYTGHYFGAWVFIAGFLLHIVVKIPHMVTGLRSIPMREVLGTNVA
FT                   DTRAQPCDPDGLVSVNPGEATLSRRGALGLVGAGVLLIGVLTVGQTLGGFTRKAALLLP
FT                   RGRVVSPGDFPVNKTAAAAGITAEAIGPDWRLVLRGGPAEVVLDRATLAGLPQRTARLP
FT                   LACVEGWSAVRTWSGVPLAELALLAGVPAARSARVTSLQRGGAFGEAKLAANQIADPDA
FT                   LLALRVDGADLSLDHGYPARIIVPALPGVHNTKWVAGIEFHKR"
     MSDPARGAEA EDAYGFPAGL WRWLQRHPPP ALHRLTRFRS PLRGPWLTSV FGLVLLVALP        60
     FVIITGLLSY IAYAPQLGQA IPGDVGWLRL PAFTWPTRPS WLYRLTQGLH VGLGLVIIPV       120
     VLAKLWSVIP RLFVWPPARS IAQVLERLSV LMLVGGILFQ IVTGVLNIQY DYIFGFSFYT       180
     GHYFGAWVFI AGFLLHIVVK IPHMVTGLRS IPMREVLGTN VADTRAQPCD PDGLVSVNPG       240
     EATLSRRGAL GLVGAGVLLI GVLTVGQTLG GFTRKAALLL PRGRVVSPGD FPVNKTAAAA       300
     GITAEAIGPD WRLVLRGGPA EVVLDRATLA GLPQRTARLP LACVEGWSAV RTWSGVPLAE       360
     LALLAGVPAA RSARVTSLQR GGAFGEAKLA ANQIADPDAL LALRVDGADL SLDHGYPARI       420
     IVPALPGVHN TKWVAGIEFH KR                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page