(data stored in ACNUC1104 zone)

EMBL: CP000717.PE231

CP000717.PE231       Location/Qualifiers
FT   CDS             complement(274624..275304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10231"
FT                   /old_locus_tag="TBFG_00228"
FT                   /product="conserved membrane protein"
FT                   /note="Mapped to H37Rv Rv0229c"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10231"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04574"
FT                   /protein_id="ABR04574.1"
FT                   /translation="MRQPRRANAMGLALCIYIGSLLIYTPIHGETSRRHRRAGFKHGSY
FT                   RIGHDDDQRHRQRGPAASHVSASSTRRRRSRHAGRRTARGPRRSMALKYLLDTSVIKRL
FT                   SRPAVRRAVEPLAEAGAVARTQITDLEVGYSARNETEWQRLMVALSAFDLIESTASHHR
FT                   RALGIQRLLAARSQRGRKIPDLLIAAAGEEHGLVVLHYDADFDLIAAVTGQPCQWIVPA
FT                   GTID"
     MRQPRRANAM GLALCIYIGS LLIYTPIHGE TSRRHRRAGF KHGSYRIGHD DDQRHRQRGP        60
     AASHVSASST RRRRSRHAGR RTARGPRRSM ALKYLLDTSV IKRLSRPAVR RAVEPLAEAG       120
     AVARTQITDL EVGYSARNET EWQRLMVALS AFDLIESTAS HHRRALGIQR LLAARSQRGR       180
     KIPDLLIAAA GEEHGLVVLH YDADFDLIAA VTGQPCQWIV PAGTID                      226
//

If you have problems or comments...

PBIL Back to PBIL home page