(data stored in ACNUC1104 zone)

EMBL: CP000717.PE239

CP000717.PE239       Location/Qualifiers
FT   CDS             complement(287216..287389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10239"
FT                   /old_locus_tag="TBFG_00236"
FT                   /product="small secreted protein"
FT                   /note="Mapped to H37Rv Rv0236A"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10239"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04582"
FT                   /protein_id="ABR04582.1"
FT                   /translation="MNRIVAPAAASVVVGLLLGAAAIFGVTLMVQQDKKPPLPGGDPSS
FT                   SVLNRVEYGNRS"
     MNRIVAPAAA SVVVGLLLGA AAIFGVTLMV QQDKKPPLPG GDPSSSVLNR VEYGNRS           57
//

If you have problems or comments...

PBIL Back to PBIL home page