(data stored in ACNUC1104 zone)

EMBL: CP000717.PE242

CP000717.PE242       Location/Qualifiers
FT   CDS             289422..289655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="TBFG_10242"
FT                   /old_locus_tag="TBFG_00239"
FT                   /product="conserved hypothetical protein"
FT                   /note="Mapped to H37Rv Rv0239"
FT                   /db_xref="EnsemblGenomes-Gn:TBFG_10242"
FT                   /db_xref="EnsemblGenomes-Tr:ABR04585"
FT                   /protein_id="ABR04585.1"
FT                   /translation="MIRTQVQLPDELYRDAKRVAHEHEMTLAEVVRRGLEHMVRIYPRR
FT                   DAASDTWQPPTPRRLGPFRASEETWRELANEA"
     MIRTQVQLPD ELYRDAKRVA HEHEMTLAEV VRRGLEHMVR IYPRRDAASD TWQPPTPRRL        60
     GPFRASEETW RELANEA                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page